SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024605 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024605
Domain Number 1 Region: 820-950,991-1164
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.2e-76
Family Protein kinases, catalytic subunit 0.00000000168
Further Details:      
 
Domain Number 2 Region: 669-763
Classification Level Classification E-value
Superfamily Immunoglobulin 3.63e-17
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 233-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000166
Family V set domains (antibody variable domain-like) 0.069
Further Details:      
 
Domain Number 4 Region: 347-450
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000483
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 557-590,622-657
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000106
Family V set domains (antibody variable domain-like) 0.05
Further Details:      
 
Domain Number 6 Region: 438-552
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000055
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024605   Gene: ENSMMUG00000018693   Transcript: ENSMMUT00000026284
Sequence length 1359
Comment pep:known_by_projection chromosome:MMUL_1:6:177303829:177348623:-1 gene:ENSMMUG00000018693 transcript:ENSMMUT00000026284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRSAALCLRLGLCLGLLDGLASGYSMTPPTLNITEESHVVDTGDSLSISCRGVPSPTGR
PGRLQKPKAGGDGSTSQGRVASGLGTISAHCKLRLLGSHHSPASASGWPNLGSLQAPPPG
FTPFSCLSLRNFEQPFINKPDTLLVNRKDAMWVPCLVSVPGLNVTLRSQSSVLWPDGQEV
VWDDRRGMRVSTPLLREALYLQCETTWGDQDFLSNPFLVHITGNELYDIQLLPKKSLELL
VGEKLVLNCTVWAEFNSGVTFDWDYPGKQAERGKWVPERRSQQTHTELSSILTIHNVSQH
DLGSYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPILEATAGDELVKLPVKLAAYPP
PEFQWYKDGKALSGRHSPHALVLKEVTEASTGIYTLALWNSAAGLRRNISLELVVNVPPH
IHEKEASSPSIYSRHSRQALTCTAYGVPLPLSIHWHWRPWTPCKMFAQRSLRRRRQRDLM
PQCRDWRAVTTQDAVNPIESLDTWTEFVEGKNKTVSKLVIQNANVSAMYKCVVSNKVGQD
ERLIYFYVTTIPDGFSIESKPSEELLEGQPVLLSCQADSYKYEHLRWYRLNLSTLHDAHG
NPLLLDCKNVHLFATPLAASLEEVAPGARHATLSLSIPRVAPEHEGHYVCEVQDRRSHDK
HCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMQCLVAGAHAPSIVWYKDERLLEEKSG
VDLADSNQKLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILVGTG
VIAVFFWVLLLLIFCNMRRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEFPRE
RLHLGRVLGYGAFGKVVEASAFGINKDSSCDTVAVKMLKEGATASEHRALMSELKILIHI
GNHLNVVNLLGACTKPKGPLMVIVEYCKYGNLSNFLRAKRETFSPHAEKSPEQRGRIRAM
VELARLDRRPGSSDRVLFARFPKNEGGARRASPDQDAEDLWLSPLTMEDLVCYSFQVARG
MEFLASRKCIHRDLAARNILLSESDVVKICDFGLARDIYKDPDYVRKGSARLPLKWMAPE
SIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLRDGTRMRAPELATPAI
RRIMLNCWSGDPKARPAFSELVEILGDLLQGGGLQEEEEACMAPRGSQSSEEGSFSQVST
VALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGTQTHGSSRMKTFEEFPMTPMT
YKASVDNQTDSGMVLASEEFEQIESRHRRESGFSCKGPDQNVDVTRAHPDSQGRRRRPDR
GARGGQVFYNSEYGELSEPSEEDHCSPSARVSFFTDNSY
Download sequence
Identical sequences 9544.ENSMMUP00000024605 ENSMMUP00000024605 ENSMMUP00000024605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]