SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024680 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024680
Domain Number 1 Region: 1-101
Classification Level Classification E-value
Superfamily SRCR-like 1.07e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 2 Region: 125-178
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000122
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024680   Gene: ENSMMUG00000018751   Transcript: ENSMMUT00000026365
Sequence length 185
Comment pep:novel chromosome:MMUL_1:9:122403675:122408668:1 gene:ENSMMUG00000018751 transcript:ENSMMUT00000026365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDGSSRCSGRVEILHQGAWGTVCDDLWDLNEAEVVCRQLGCGQAVSGPGEAHFGPGSGDI
FLDNLQCSGVEHNLGQCAHLGWSEHNCGHHEDASVICSDTEDLPPPTPPGSSTASQDHIK
GRSNSCGGVTSSLSGSFSSPQYPENYPTDIQCVWEIHVDTKFRIELIILSLKIIQSKDRC
LCHLH
Download sequence
Identical sequences 9544.ENSMMUP00000024680 ENSMMUP00000024680 ENSMMUP00000024680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]