SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024756 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024756
Domain Number 1 Region: 151-206
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000097
Family Complement control module/SCR domain 0.00068
Further Details:      
 
Domain Number 2 Region: 94-146
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000721
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 3 Region: 23-88
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000012
Family Complement control module/SCR domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024756   Gene: ENSMMUG00000000240   Transcript: ENSMMUT00000026446
Sequence length 206
Comment pep:novel chromosome:MMUL_1:1:173618017:173719944:-1 gene:ENSMMUG00000000240 transcript:ENSMMUT00000026446 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLINVILTLWVSCANGQEVKPCDFPEIQHGGLYYESKRRPYFPVAAGKSYSYYCDANF
VTPSGSYWDYIHCTQDGWSPTVPCLRTCSKSDIEVENGFISESSSIYILNKEIQYKCKPG
YATADGNSSGSITCLQNGWSAQPICINSSEKCGPPPPISNGDTKSFPQKVYLPQSTVEYQ
CQSSYELQGSQYVTCSNGEWSEPPRC
Download sequence
Identical sequences ENSMMUP00000024756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]