SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024757 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024757
Domain Number 1 Region: 172-228
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000537
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 2 Region: 51-111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000472
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 3 Region: 115-167
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000144
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024757
Domain Number - Region: 9-50
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000223
Family Complement control module/SCR domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024757   Gene: ENSMMUG00000000240   Transcript: ENSMMUT00000026447
Sequence length 228
Comment pep:novel chromosome:MMUL_1:1:173617692:173721008:-1 gene:ENSMMUG00000000240 transcript:ENSMMUT00000026447 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRPYFPVAVGKYFSYYCDESFETPSGSYWDYIHCTQDGWSPAVPCLRKCYFPYLENGHN
ENNGRKFVQGNSIEVACHPGYGLPKEQTTVTCTENGWSPPPRCIHVRTCSKSDIEIENGF
ISESSSIYILNKEMQYKCKPGYATADGNSSGSITCLQNGWSAQPICINSSEKCGPPPPIS
NADTKSFPQKVYLPQSRVEYQCQSYYKLQGSQYVTCSNGEWSEPPRCI
Download sequence
Identical sequences ENSMMUP00000024757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]