SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024910 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000024910
Domain Number 1 Region: 333-431
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.89e-18
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000024910
Domain Number - Region: 185-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00224
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024910   Gene: ENSMMUG00000018930   Transcript: ENSMMUT00000026617
Sequence length 1253
Comment pep:known chromosome:MMUL_1:12:102115143:102146921:-1 gene:ENSMMUG00000018930 transcript:ENSMMUT00000026617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYAEFPPSPSNPTKEPMEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDAHQSPDAFSLMITKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGSDVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHYKRDAFSDTKFVEFLAPHDVGVFH
SFTSPYKLPLWSVCNGADSFTQECMEEKSFFCRVRVNRVSESTASFDPQLSPQGVQAAPE
KGCGAQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDERAVPLLGYLPQDL
IETPVLVQLHPSDRPLMLAIHKKILQSGGQPFDYSPIRFRTRNGEYITLDTSWSSFINPW
SRKISFIIGRHKVRVGPLNEDVFAAHPCTEEKALHPSVQELTEQIHRLLLQPVPHSGSSG
YGSLGSNGSHEHLMSQTSSSDSNGHEDSRRRRAEIYKNGNKTKNRSLYSLESGEQKKNSV
TEMQTNPSAEMKAVPAVEKDSLGASFPEELACKDQPTCSYQQISCLDSVIRYLESCNEAA
TLKRKCEFPANVPTLRSSDKRKATVSPGPHAREAEPPSRVNSHTGVSTHLTSLALPGKAE
SVASLTSQCSYSSTIVHVGDKKPQPELEMVEDAVSGPESLDCLVGPALACGLSQEKEPFK
KLGLTKEVLAAHTQKEEQSFLQKFKEIRKLSIFQSHCHYYLQERSKGQPSERTAPGLRNT
SGIDSPWRKPGKNRKLKSKRVKPRDSSESTGSGGPLPARPPLVGLNATAWSPSDTSQSSC
PAVPFPAPVPAYSLPVFPAPGTVAASPAPPHASFAVPAVPVDLQHQFAVQPPPFPAPLAP
VMAFMLPGYSFPSGTPNLPQAFFPSQPQFPSHPTITSEMASALQPEFPSRTSIPRQPCAC
PGTRATPPSAMGRASPPLFQSRSSSPLQLNLLQLEEAPEGGTGAMGTTGATETAVVGADC
KPGTSRDQQPKAPLTRDEPSDTQNSDALSTSSGFLNLLLNEDLCSASGSAASESLGSGSL
GCDTSPSRAGISDTSHTSKYFGSIDSSENNHKAKMNTGMEESEHFIKCVLQDPIWLLMAD
ADSSVMMTYQLPSRNLEAVLKEDREKLKLLQKLQPRFTESQKQELREVHQWMQTGGLPAA
IDVAECVYCENKEKGNICIPYEEDTPSLGLSEVLDTKEDENGPPLNHRMEEQT
Download sequence
Identical sequences 9544.ENSMMUP00000024910 ENSMMUP00000024910 ENSMMUP00000024910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]