SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024911 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000024911
Domain Number - Region: 185-239
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000576
Family Heme-binding PAS domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024911   Gene: ENSMMUG00000018930   Transcript: ENSMMUT00000026618
Sequence length 403
Comment pep:known chromosome:MMUL_1:12:102131096:102146921:-1 gene:ENSMMUG00000018930 transcript:ENSMMUT00000026618 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGYAEFPPSPSNPTKEPMEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDD
SGKELGMLVEPPDAHQSPDAFSLMITKSEHNPSTSGCSSDQSSKVDTHKELIKTLKELKV
HLPADKKAKGKASTLATLKYALRSVKQVKANEEYYQLLMSSEGHPCGSDVPSYTVEEMES
VTSEHIVKNADMFAVAVSLVSGKILYISDQVASIFHYKRDAFSDTKFVEFLAPHDVGVFH
SFTSPYKLPLWSVCNGADSFTQECMEEKSFFCRVRVNRVSESTASFDPQLSPQGVQAAPE
KGCGAQLCCLLLAERVHSGYEAPRIPPEKRIFTTTHTPNCLFQDVDESPAVGRAAFRLLS
HSVSHPERGVHHAGYQLVQLHQPMEQENLLHHWEAQSQGGPHS
Download sequence
Identical sequences ENSMMUP00000024911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]