SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000024985 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000024985
Domain Number - Region: 17-56
Classification Level Classification E-value
Superfamily Ribosomal protein S7 0.00256
Family Ribosomal protein S7 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000024985   Gene: ENSMMUG00000018997   Transcript: ENSMMUT00000026699
Sequence length 58
Comment pep:novel chromosome:MMUL_1:X:4037458:4038434:-1 gene:ENSMMUG00000018997 transcript:ENSMMUT00000026699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEWETAAPAVAETLDIKLFGKWSTDDMQINDISLQDYIAVTEKYAKYLPHSAGYYTA
Download sequence
Identical sequences ENSMMUP00000024985 ENSMMUP00000024985 9544.ENSMMUP00000024985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]