SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025101 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025101
Domain Number 1 Region: 341-466
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 2 Region: 277-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000129
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 3 Region: 315-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000234
Family EGF-type module 0.0099
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025101
Domain Number - Region: 227-250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0688
Family EGF-type module 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025101   Gene: ENSMMUG00000019093   Transcript: ENSMMUT00000026826
Sequence length 587
Comment pep:known_by_projection chromosome:MMUL_1:19:45848475:45858746:1 gene:ENSMMUG00000019093 transcript:ENSMMUT00000026826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPRMSRLLSQTVILALIFIPQARPAGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFF
RVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTF
SLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCEL
LAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCL
EGWTGPLCTVPVSTSSCLGLRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPGSFECTC
PRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQ
PCRNGGLCLDLGHALRCRCRAGFAGPRCEHNLDDCAGRACANGGTCVEGGGAHRCSCALG
FGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGSRCEFPVHPDGVSALPAAP
PGLRPGDPQRYLLPPALGLLVAAGVAGAALLLVHVRRRGHAQDAGSRLLAGTPEPSVHAL
PDALNNLRTQEGPGDVPSSSVDWNRPEDVDSRGIYVISAPSIYAREA
Download sequence
Identical sequences F6TFV4
ENSMMUP00000025101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]