SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025148 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025148
Domain Number 1 Region: 67-199
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-33
Family C-type lectin domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 47-74
Classification Level Classification E-value
Superfamily Triple coiled coil domain of C-type lectins 0.0000000785
Family Triple coiled coil domain of C-type lectins 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025148   Gene: ENSMMUG00000019129   Transcript: ENSMMUT00000026878
Sequence length 202
Comment pep:known chromosome:MMUL_1:2:91495801:91505759:-1 gene:ENSMMUG00000019129 transcript:ENSMMUT00000026878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELWGAYLLLCLFSLLTQVTTEPPTQKPKKVVNAKKDVVSTKMFEELKSRLDTLAQEVAL
LKEQQALQTVCLKGTKVHMKCFLAFTQAKTFHEASEDCISRGGTLGTPQTGSENDALYEY
LRQSVGNEAEIWLGLNDMATEGIWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAA
NGKWFDKRCRDPLPYICQFGIV
Download sequence
Identical sequences A0A096NPW2 A0A2K5JR22 A0A2K5KNM3 A0A2K5W3G8 A0A2K5ZQR2 A0A2K6BMB1 A0A2K6M5D3 A0A2K6RCL0 F6T0W5
9544.ENSMMUP00000025148 XP_005546929.1.63531 XP_010372689.1.97406 XP_011737303.1.29376 XP_011808039.1.43180 XP_011836491.1.47321 XP_011888706.1.92194 XP_014986642.1.72884 XP_017731752.1.44346 ENSMMUP00000025148 ENSMMUP00000025148 ENSPANP00000015050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]