SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025152 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025152
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-46
Family V set domains (antibody variable domain-like) 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025152   Gene: ENSMMUG00000019133   Transcript: ENSMMUT00000026882
Sequence length 118
Comment pep:known_by_projection scaffold:MMUL_1:1099548049584:187218:187895:1 gene:ENSMMUG00000019133 transcript:ENSMMUT00000026882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVRLVESGGGLVQPGGSLRLSCAASGFTFSDYYMSWVRQAPGKGPEWVGFIRNKANGGTA
EYAASVKGRFTISRDDSKSIASLQMNSLKTEDTAVYYCARDTVRRAFAGISNHITIGI
Download sequence
Identical sequences ENSMMUP00000025152 ENSMMUP00000025152 9544.ENSMMUP00000025152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]