SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025309 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025309
Domain Number 1 Region: 1225-1486
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-34
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 125-296,343-398
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.67e-33
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 3 Region: 542-775
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.1e-31
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 904-1059,1099-1177
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.45e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025309   Gene: ENSMMUG00000019262   Transcript: ENSMMUT00000027053
Sequence length 2176
Comment pep:known chromosome:MMUL_1:2:82530117:82851229:-1 gene:ENSMMUG00000019262 transcript:ENSMMUT00000027053 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMMMMMKKMQHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPRPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVSTLGREFPWTCLLAVSILLAFFLGNWNLTSLAGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVSG
EGETRGCCGSLWCWWRRRGAAKAGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAVK
SVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQA
YFVSLFNRFDCFVVCGGITETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVA
SLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQI
LTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESL
NTAQKEEAEEKERKKIARKESLENKKNNKPEVNQVANSDNKVTIDDYREEDEDKDPYPPC
DVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHK
LINHHVFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTTF
GAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGL
KHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFIL
YKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENIGPI
YNHRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALK
ARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDILN
MVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESENVPVPT
ATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLF
FIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLC
DPESDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHH
LDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKVSVLASPSLGSG
GTRIINITINLVLAMCLTQNSWNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVT
VGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQVNCYTAHSPKCGLAISGPQGK
DPTELAEFVFHVEKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEK
PLFPPAGNSVCHNHHNHNSIGKQVPTSTNANLNNANMSKAAHGKRPSIGNLEHVSENGHH
SSHKHDREPQRRSSVKRTRYYETYIRSDSGDEQLPTICREDPEIHGYFRDPRCFGEQEYF
SSEECYEDDSSPTWSSRNSRPEGEWSWRKRTTERQVPFHHPLGALREEMSGQPCPHDSAS
PTVCMMPFAFPAHRRSSFNFECLRRQSSQEEVPSSPTFPHRTALPLHLMQQQIMAVAGLD
SSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQMNGSLPSLHRSSWY
TDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATK
HEIADACDLTIDEMESAASTLLNGNVCPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPG
RDEEDLADEMICITTL
Download sequence
Identical sequences ENSMMUP00000025309 9544.ENSMMUP00000025309 ENSMMUP00000025309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]