SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025348 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025348
Domain Number 1 Region: 9-245
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.55e-71
Family Eukaryotic proteases 0.00000000705
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025348   Gene: ENSMMUG00000019294   Transcript: ENSMMUT00000027095
Sequence length 247
Comment pep:known chromosome:MMUL_1:7:87390195:87392979:-1 gene:ENSMMUG00000019294 transcript:ENSMMUT00000027095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLPLPLLLFFLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKSCGGFLIRRNF
VLTAAHCAGRSITVTLGAHNITEKEDTWQKLEVIKQFRHPKYNTSTLHHDIMLLKLKEKA
SLTLAVGTLPFPSQFNFVPPGRMCRVAGWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRY
FDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRLDAKPPAVFTRISHYRPWI
NKILQAN
Download sequence
Identical sequences F6SAJ2 G7PA00
NP_001181562.1.72884 ENSMMUP00000025348 9544.ENSMMUP00000025348 ENSMMUP00000025348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]