SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025444 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025444
Domain Number 1 Region: 58-533
Classification Level Classification E-value
Superfamily ALDH-like 2.36e-166
Family ALDH-like 0.0000000799
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025444   Gene: ENSMMUG00000019368   Transcript: ENSMMUT00000027200
Sequence length 535
Comment pep:known_by_projection chromosome:MMUL_1:4:24502581:24536512:1 gene:ENSMMUG00000019368 transcript:ENSMMUT00000027200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFWLRSCGARRLGSTFPGCRLHPRAGGLVPAPGPAPGPAQLRGYVGGLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVSEARAAVRAAYEAFCSWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY
TPAKDKRALVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AELASQAGIPPGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTTTGKILLHHAANSV
KRVSMELGGLAPFIVFDSANVDQAVAGALASKFRNTGQTCVCSNRFLVQRGIHDAFVKAF
AEAMKKNLHVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATIVTGGKRHHLGKNFF
EPTLLSNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANATDVGLAGYFYSQDPAQIWR
VAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLELKYVCYGGL
Download sequence
Identical sequences F6T9P0
XP_001101142.1.72884 ENSMMUP00000025444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]