SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025446 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025446
Domain Number 1 Region: 58-546
Classification Level Classification E-value
Superfamily ALDH-like 9.03e-162
Family ALDH-like 0.000000104
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025446   Gene: ENSMMUG00000019368   Transcript: ENSMMUT00000027202
Sequence length 548
Comment pep:known_by_projection chromosome:MMUL_1:4:24502609:24536512:1 gene:ENSMMUG00000019368 transcript:ENSMMUT00000027202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCFWLRSCGARRLGSTFPGCRLHPRAGGLVPAPGPAPGPAQLRGYVGGLAGLSAALLR
TDSFVGGRWLPAAATFPVQDPASGAALGMVADCGVSEARAAVRAAYEAFCSWREVSAKER
SSLLRKWYNLMIQNKDDLARIITAESGKPLKEAHGEILYSAFFLEWFSEEARRVYGDIIY
TPAKDKRALVLKQPVGVAAVITPWNFPSAMITRKVGAALAAGCTVVVKPAEDTPFSALAL
AEVQAILCLSLPSFLLASQAGIPPGVYNVIPCSRKNAKEVGEAICTDPLVSKISFTGSTT
TGKILLHHAANSVKRVSMELGGLAPFIVFDSANVDQAVAGALASKFRNTGQTCVCSNRFL
VQRGIHDAFVKAFAEAMKKNLHVGNGFEEGTTQGPLINEKAVEKVEKQVNDAVSKGATIV
TGGKRHHLGKNFFEPTLLSNVTQDMLCTHEETFGPLAPVIKFDTEEEAIAIANATDVGLA
GYFYSQDPAQIWRVAEQLEVGMVGVNEGLISSVECPFGGVKQSGLGREGSKYGIDEYLEL
KYVCYGGL
Download sequence
Identical sequences 9544.ENSMMUP00000025446 ENSMMUP00000025446 ENSMMUP00000025446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]