SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025625 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025625
Domain Number 1 Region: 2-435
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-156
Family ALDH-like 0.000000000000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025625   Gene: ENSMMUG00000019504   Transcript: ENSMMUT00000027399
Sequence length 440
Comment pep:known_by_projection chromosome:MMUL_1:7:36286694:36352774:-1 gene:ENSMMUG00000019504 transcript:ENSMMUT00000027399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFINNEWQNSESGRVFPVYNPATGEQVCEVQEADKADIDKAVQAARLAFSLGSVWRRMDA
SERGRLLDKLADLLTATSASQTMESLNGGKPFLQAFYVDLQGVIKTLRYYAGWADKIHGM
TIPVDGDYFTFTRHEPIGVCGQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSAL
YMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQ
CCTAGSRIFVEESIYEEFVRRSVERAKRRIVGSPFDPTTEQGPQIDKKQYNKILELIQSG
VAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERA
NNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEF
GLREYSEVKTVTVKIPQKNS
Download sequence
Identical sequences ENSMMUP00000025626 9544.ENSMMUP00000025625 ENSMMUP00000025625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]