SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025665 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025665
Domain Number 1 Region: 97-323
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.14e-45
Family Voltage-gated potassium channels 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025665   Gene: ENSMMUG00000019536   Transcript: ENSMMUT00000027442
Sequence length 640
Comment pep:known_by_projection chromosome:MMUL_1:1:43665950:43721276:1 gene:ENSMMUG00000019536 transcript:ENSMMUT00000027442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAPPRRLGLGPSPGDAPRAELVALTAVQSEQGEAGGGGSPRRRGLLGSPLPPGAPLPG
LGSGSGSACGQRSSAAHKRYRRLQNWVYNVLERPRGWAFVYHVFIFLLVFSCLVLSVLST
IQEHQELANECLLILEFVMIVVFGLEYIVRVWSAGCCCRYRGWQGRFRFARKPFCVIDFI
VFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWKLLGSVVYAHSKELIT
AWYIGFLVLIFASFLVYLAEKDANSDFSSYADSLWWGTITLTTIGYGDKTPHTWLGRVLA
AGFALLGISFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLIQAAWRLYSTDMSRA
YLTATWYYYDSILPSFRNCMGVAPREGLLIASRSLRPSAAWLCPKGSPPPPSAHSPGPGP
APTSSYNPWKVNRRIFGNIVGAQQIAKHKQAPSEEVAEEKGYQCELTVDDVMPAVKTVIR
SVRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQTRVDQIVGRGPGDRK
AREKGDKGPSDAEVVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRSGTSASLGTV
QVPLFDPDITSDYHSPVDHEDISVSAQTLSISRSVSTNMD
Download sequence
Identical sequences ENSMMUP00000025665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]