SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025736 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025736
Domain Number 1 Region: 394-569,599-660
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.59e-44
Family Voltage-gated potassium channels 0.0029
Further Details:      
 
Domain Number 2 Region: 38-133
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.14e-20
Family Flavin-binding PAS domain 0.0000264
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000025736
Domain Number - Region: 664-711
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000944
Family cAMP-binding domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025736   Gene: ENSMMUG00000019591   Transcript: ENSMMUT00000027517
Sequence length 731
Comment pep:known_by_projection chromosome:MMUL_1:12:25996244:26413243:-1 gene:ENSMMUG00000019591 transcript:ENSMMUT00000027517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLGTIIRKFEGQNKKFIIANARVQNCAIIYCNDGFCEMTGFSRPDVM
QKPCTCDFLHGPETKRHDIAQIAQALLGSEERKVEVTYYHKNGSTFICNTHIIPVKNQEG
VAMMFIINFEYVTDENAATPERVNPILPVKTVNRKFFGFKFPGLRVLTYRKQSLPQEDPD
VVVIDSSKHSDDSVAMKHFKSPTKESCSPSEADDTKALIQPSKCSPLVNISGPLDHSSPK
RQWDRLYPDMLQSSSQLSHSRSRESLCSIRRASSVHDIEGFSVHPKNIFRDRHASEGPFN
HIKSSLLGSTSDSNLNKYSTINKIPQLTLNFSEAKTEKKNSSPPSSDKTIIAPKVKDRTH
NVTEKVTQVLSLGADVLPEYKLQTPRINKFTILHYSPFKAVWDWLILLLVIYTAIFTPYS
AAFLLNDREEQKRRECGYSCSPLNVVDLIVDIMFIIDILINFRTTYVNQNEEVVSDPAKI
AIHYFKGWFLIDMVAAIPFDLLIFGSGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYG
AAVLMLLMCIFALIAHWLACIWYAIGNVERPYLTDKIGWLDSLGQQIGKRYNDSDSSSGP
SIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFGNVSAIIQR
LYSGTARYHMQMLRVKEFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNMVCMSVFQNES
ATGIIVIAKME
Download sequence
Identical sequences XP_005573384.1.63531 ENSMMUP00000025736

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]