SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025835 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025835
Domain Number 1 Region: 21-128
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.000001
Further Details:      
 
Domain Number 2 Region: 134-245
Classification Level Classification E-value
Superfamily POZ domain 0.0000651
Family BTB/POZ domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025835   Gene: ENSMMUG00000019662   Transcript: ENSMMUT00000027622
Sequence length 584
Comment pep:known_by_projection chromosome:MMUL_1:16:74230601:74239136:-1 gene:ENSMMUG00000019662 transcript:ENSMMUT00000027622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPRLFWVWLLVAGTQGMNDGDMRLADGGATNQGRVEIFYRGQWGTVCDNLWDLTDASV
VCRALGFENATQALGRAAFGQGSGPIMLDEVQCMGTEASLADCKSLGWLKSNCRHERDAG
VVCTNETRSTHTLDLSRELSEVLGQIFDSQQGCDLSISVSVQGEDALGFCGHTIILTANL
EAQALWKEPGSNVTISVDAECVPMVRDFLRYFYSRRIDIALSSVKCFHKLASAYGAKQLQ
GYCASLFAILLPQDPSFQTPLDLYAYALATGDTLLEKLCLQFLAWNFEALTQAEAWPSVP
TDVLQLLLPRSDLVVPSELALLKAVDTWSWGERASHEEVEGLVEKVRFPMMLPEELFELQ
FNLTLYWSHKALFQRKTLQALEFHTVPFQLLARYKGLNLTEDAYKPRIYTSPTWSASVTD
SSWSARKSQLVYQSRQGPLVKYSNYFQAPSDYRYYPYQSFQTPQHPSFLFQDKRVSWSLV
YLPTIQSCWNYGFSCSSDELPILGLTKSGGSDRSIAYENKALMLCEGLFVADATDFEGRK
AAIPSALDTNSSKSTSFFPCPAGHFNSFRTVIRPFYLTNSSGVD
Download sequence
Identical sequences ENSMMUP00000025835 9544.ENSMMUP00000025835 ENSMMUP00000025835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]