SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000025850 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000025850
Domain Number 1 Region: 338-550
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.09e-60
Family Eukaryotic proteases 0.00000000557
Further Details:      
 
Domain Number 2 Region: 104-197
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-32
Family Kringle modules 0.0000082
Further Details:      
 
Domain Number 3 Region: 208-297
Classification Level Classification E-value
Superfamily Kringle-like 1.01e-27
Family Kringle modules 0.00000898
Further Details:      
 
Domain Number 4 Region: 45-105
Classification Level Classification E-value
Superfamily GLA-domain 2.02e-19
Family GLA-domain 0.0000951
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000025850   Gene: ENSMMUG00000019674   Transcript: ENSMMUT00000027637
Sequence length 550
Comment pep:known chromosome:MMUL_1:14:25388266:25398693:-1 gene:ENSMMUG00000019674 transcript:ENSMMUT00000027637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHVRGLQLPGCLALAALCSLVHSQHVFLAPQQALSLLQRVRRASSGFLEEVFKGNLERE
CVEETCSYEEAFEALESSTATDAFWAKYTACETARTSRDTLAACLEGNCAEDLGTNYRGH
VNITRSGIECQLWRSRYPHKPEINSTTHPGADLQENFCRNPDSSTTGPWCYTTDPTVRRE
ECSIPVCGQDQVTVAMTPRSSVNLSLPSEECVPDRGRQYQGHLAVTTHGLPCLAWASAQA
KALSKHQDFDSAVQLVENFCRNPDGDEEGVWCYVAGKPGDFEYCDLNYCEEAVDEETGDG
LGEDPDRAIEGRTATSEYQTFFDPRTFGLGEADCGLRPLFEKKSLEDKTEGELLESYIDG
RIVEGWDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTENDL
LVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDIALMKLKKPITFSDYIHPVC
LPDRETAASLFQAGYKGRVTGWGNLKETWTTNVGKVQPSVLQVVNLPIVERSVCKDSTRI
RITDNMFCAG
Download sequence
Identical sequences ENSMMUP00000025850 ENSMMUP00000025850 9544.ENSMMUP00000025850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]