SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026050 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026050
Domain Number 1 Region: 369-613
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.28e-79
Family Eukaryotic proteases 0.00016
Further Details:      
 
Domain Number 2 Region: 196-305
Classification Level Classification E-value
Superfamily Kringle-like 1.67e-33
Family Kringle modules 0.00032
Further Details:      
 
Domain Number 3 Region: 36-90
Classification Level Classification E-value
Superfamily Kringle-like 2.3e-19
Family Fibronectin type II module 0.0048
Further Details:      
 
Domain Number 4 Region: 96-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000379
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026050
Domain Number - Region: 177-205
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0193
Family EGF-type module 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026050   Gene: ENSMMUG00000019816   Transcript: ENSMMUT00000027845
Sequence length 615
Comment pep:known_by_projection chromosome:MMUL_1:6:173929826:173938651:-1 gene:ENSMMUG00000019816 transcript:ENSMMUT00000027845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKALLLLGFLLVSLESTLSIPPWKAPKEHKYKAEEHTVVLTVTGEPCHFPFQYHRRLYHK
CTHKGRPGPQTWCATTPNFDEDQRWGYCVEPKKVKDHCSKHSPCQKGGTCVNTLSGTHCL
CPQHLTGNHCQREKCFEPQLLRFFHENEIWYRSEQAAVARCQCKGPDAHCQRLASQACRT
NPCLHGGRCLEVEGHRLCHCPVGYTGPFCDLDTKASCYDGRGLSYRGLARTTLSGAPCQP
WTSEATYWNVTAEQARNWGLGGHAFCRNPDNDIRPWCFVLIGDRLSWEYCDVAQCQAPTQ
AAPPTPVSPGLHVPLMPPQPAPPKLQPTTRTPPQSQTPGALPVKQEQPPRLTRNGSVSCG
QRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAP
EDLTVVLGQERHNHSCEQCQTLAVRSYRLHEAFSPDSYQHDLALLRLQEDADGSCALLSP
YVQPVCLPSGAARPSEPALCQVAGWGHQFEGAEEYSSFLQEAQVPFLSLESCSAPEVHGA
SILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYT
DVAYYLAWIREHTAS
Download sequence
Identical sequences F7FY72
ENSMMUP00000026050 XP_001089771.1.72884 ENSMMUP00000026050 9544.ENSMMUP00000026050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]