SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026058 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026058
Domain Number 1 Region: 147-253
Classification Level Classification E-value
Superfamily C-type lectin-like 1.62e-37
Family Link domain 0.0012
Further Details:      
 
Domain Number 2 Region: 255-338
Classification Level Classification E-value
Superfamily C-type lectin-like 6.59e-23
Family Link domain 0.0018
Further Details:      
 
Domain Number 3 Region: 43-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000142
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026058   Gene: ENSMMUG00000019821   Transcript: ENSMMUT00000027853
Sequence length 340
Comment pep:known chromosome:MMUL_1:1:135225652:135232188:1 gene:ENSMMUG00000019821 transcript:ENSMMUT00000027853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGPTLPTLCCFLLWVFTIFHKGQGDPASHPGPHYLLPPIHEVIHSHRGATATLPCVLG
TTPPSYKVRWSKVEPGELRETLILVTNGLHARGYGPLGGRARMRRGHRLDASLVIAGVRL
EDEGRYRCELINGIEDESVALTLSLEGVVFPYQPSRGRYQFNYYEAKQACEEQDGRLATY
SQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGRGRPGIRSYGPRDRMRDRYDAFC
FTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYAAWKFSGLDQCDGGWLADGSV
RFPIITPRPRCGGLPDPGVRSFGFPRPQQAAYGTYCYAEN
Download sequence
Identical sequences A0A2K5WER6 F7FY38
ENSMMUP00000026058 9544.ENSMMUP00000026058 ENSMMUP00000026058 NP_001252781.1.72884 XP_005541483.1.63531 XP_015311104.1.63531 XP_015311111.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]