SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026073 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026073
Domain Number 1 Region: 211-293
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000651
Family I set domains 0.05
Further Details:      
 
Domain Number 2 Region: 19-103
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000172
Family I set domains 0.0055
Further Details:      
 
Domain Number 3 Region: 297-386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000203
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 107-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000568
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026073   Gene: ENSMMUG00000019830   Transcript: ENSMMUT00000027868
Sequence length 508
Comment pep:known_by_projection chromosome:MMUL_1:1:136323422:136352800:-1 gene:ENSMMUG00000019830 transcript:ENSMMUT00000027868 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLWSLLVIFAAVTEQADSLTLVAPSSVFEGDSIVLKCQGEQNWKIRKMTYHKDNKELSV
FEKVSDFLIQSAVLSDSGNYFCSTKGNIFLRDKRSDIVKIKVQELFQHPVLTASSFQPIE
GGPVSLKCETQLSPQRLDVQLQFCFFRENQVLGSRWSSSPELQIPAMWSEDTGSYWCEAE
TVTHRIRKQSLRSQIHVQRIPISNVSLETRAPGGQVTEGQKLILLCSVTAGTGNVTFSWY
REATGTSLGMKTQHSLSAELEIPAVKESDAGKYYCRADNGHESIQSKVVNIPVRIPVSRP
VLTLRSPGAQTAVGDLLELHCEALRGSPPILYRFYHEDVTLGNSSAPSGGGASFNLSLTA
EHSGNYSCEADNGLGAHHSEAVPVSISGPDGHRRDFMTAGIFWGLFGVLVFIGVVLLLYF
LFQKISGESSATNEPRGDCRLNPQEFTYSSPIPKTEELQPVYVNVGSVDVDVVYSQVWSI
QQPESSANIRTLLENKDSQVIYSSVKKS
Download sequence
Identical sequences ENSMMUP00000026073 ENSMMUP00000026073 9544.ENSMMUP00000026073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]