SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026080 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026080
Domain Number 1 Region: 238-347
Classification Level Classification E-value
Superfamily SRCR-like 9.29e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00056
Further Details:      
 
Domain Number 2 Region: 21-127
Classification Level Classification E-value
Superfamily SRCR-like 1.03e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00037
Further Details:      
 
Domain Number 3 Region: 137-241
Classification Level Classification E-value
Superfamily SRCR-like 2.22e-33
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026080   Gene: ENSMMUG00000019835   Transcript: ENSMMUT00000027876
Sequence length 348
Comment pep:known_by_projection chromosome:MMUL_1:1:136408425:136416710:-1 gene:ENSMMUG00000019835 transcript:ENSMMUT00000027876 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLFSLILAICTRPGFLASPPGVRLVGGLHRCEGRVEVRQNGQWGTVCDDGWDIKDVAV
VCRELGCGAANGTPSGILYEPPAENEQKVFIQEVSCTGTEDTLAQCEQEEAYNCLHNEDA
GALCENPESPLSPVPENVRLADGPGHCKGRVEVKHQNRWYSVCQTGWSLRAAKVVCRQLG
CGRAVLTQKRCNKPAQGQRSIWLSQMSCSGREATLQDCPSGPWGKSTCIHDEDTWVECED
PFDLRLVGGDKLCSGRLEVLHKGVWGSVCDDNWGEKEDQVVCKQLDCGKSLSPSFKDRKS
YGPGVGRIWLDNVRCLGEEQSLEQCQHRFWGYHDCTHQEDVAVICSGK
Download sequence
Identical sequences ENSMMUP00000026080 ENSMMUP00000026080 9544.ENSMMUP00000026080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]