SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026090 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026090
Domain Number 1 Region: 438-773
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.32e-109
Family PDEase 0.00000186
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026090
Domain Number - Region: 94-160
Classification Level Classification E-value
Superfamily CheY-like 0.000211
Family CheY-related 0.0084
Further Details:      
 
Domain Number - Region: 238-278
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0586
Family Heme-binding PAS domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026090   Gene: ENSMMUG00000019838   Transcript: ENSMMUT00000027887
Sequence length 783
Comment pep:known chromosome:MMUL_1:7:64128682:64283261:-1 gene:ENSMMUG00000019838 transcript:ENSMMUT00000027887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCAPSIHISESLEAEDAPSPAASPLSSGGPRLPQGQKTAALSRTRGAGLLELEPRDGSG
KKVAVADVQFGPMRFHQDQLQVLLVFTKEDNQCNGFCRACEKAGFKCTVTKEAQAVLACF
LDKHHDIIIIDHRNPRQLDAEALCRSIRSSKLSENTVIVGVVRRVDREELSVMPFIAAGF
TRRYVENPNIMACYNELLQLEFGEVRSQLKLRACNSVFTALENSEDAIEITSEDRVIQEW
QGIYYAKKKNGDNIQQNVKIIPVIGQGGKIRHYVSIIRVCNGNNKAEKIPECVQSDTHTD
NQTGKHKDRRKGSLDVKAVASRTTEVSSQRRHSSMARIHSMTIEAPITKVINIINAAQES
SPMPVTEALDRVLEILRTTELYSPQFGAKDDDPHANDLVGGLMSDGLRRLSGNEYVLSTK
NTQTVSSNIITPISLDDVPPRIARAMENEEYWDFDIFELEAATHNRPLIYLGLKMFARFG
ICEFLHCSESTLRSWLQIIEANYHSSNPYHNSTHSADVLHATAYFLSKERIKETLDPIDE
VAALIAATIHDVDHPGRTNSFLCNAGSELAILYNDTAVLESHHAALAFQLTTGDDKCNIF
KNMERNDYRTLRQGIIDMVLATEMTKHFEHVNKFVNSINKPLATLEENGETDKNQEMINT
MLRTPENRTLIKRMLIKCADVSNPCRPLQYCIEWAARISEEYFSQTDEEKQQDLPVVMPV
FDRNTCSIPKSQISFIDYFITDMFDAWDAFVDLPDLMQHLDNNFKYWKGLDEMKLRSLRP
PPE
Download sequence
Identical sequences A0A2K5VH09 A0A2K6E525 F7FU15
ENSMMUP00000026090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]