SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026202 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026202
Domain Number 1 Region: 21-236
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.51e-34
Family YicI N-terminal domain-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026202   Gene: ENSMMUG00000029357   Transcript: ENSMMUT00000028008
Sequence length 236
Comment pep:novel scaffold:MMUL_1:1099214738717:307:4040:-1 gene:ENSMMUG00000029357 transcript:ENSMMUT00000028008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRDDEKIDCYPDENGASAENCTARGCIWEASNSSGVPICHFVNDLYSVSNVQYNSHGATA
DISLKSSVYANAFPSTPVNPLRLDVTYHKNEMLQFKIYDPNNNRYEVPVPLNVPTVPSST
PEGQLYDVLIKKNPFGIEIRRKSTGTIIWDSQLLGFTFNDMFIRISTRLASKYLYGFGET
EHTSYRRDLEWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVFLLNSNAM
Download sequence
Identical sequences ENSMMUP00000026202 ENSMMUP00000026202 9544.ENSMMUP00000026202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]