SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026204 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026204
Domain Number 1 Region: 108-306,350-511
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.51e-74
Family YicI catalytic domain-like 0.00032
Further Details:      
 
Domain Number 2 Region: 2-105
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.26e-23
Family YicI N-terminal domain-like 0.0053
Further Details:      
 
Domain Number 3 Region: 514-594
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.15e-19
Family Putative glucosidase YicI, domain 3 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026204   Gene: ENSMMUG00000019937   Transcript: ENSMMUT00000028010
Sequence length 639
Comment pep:novel chromosome:MMUL_1:3:179596089:179625377:1 gene:ENSMMUG00000019937 transcript:ENSMMUT00000028010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLSISTRLPSQYIYGFGETEHTTFRRNMTWNTWGMFARDEPPAYKKNSYGVHPYYMALE
EDGSAHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPA
MIPYWALGFQLSRYGYENDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQN
LSLLIEQMKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTSDIVWGKVWPDL
PNVIVDGSLDHATQVKLYKAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLW
IDMNEPSNFVDGSVRGCSDEMLNNPPYMPYLESRDNGLNSKTLCMESQQILPDGSPVKHY
NVHSLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAAWDQLGKSII
GMMEFSLFGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNS
AFEVLSRKVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDHQFMLGPA
ILISPVLETSTFEISAYFPRARWYDYSTGTSSQSTGQRKILKAPLDHINLHVRGGYILPW
QEPAMNTHSSRQNFMGLTVALDDNGKAEGQMFWDDGQSI
Download sequence
Identical sequences ENSMMUP00000026204 ENSMMUP00000026204 9544.ENSMMUP00000026204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]