SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026251 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026251
Domain Number 1 Region: 80-215
Classification Level Classification E-value
Superfamily L domain-like 4.83e-29
Family Ngr ectodomain-like 0.005
Further Details:      
 
Domain Number 2 Region: 306-423
Classification Level Classification E-value
Superfamily Hormone receptor domain 9.16e-17
Family Hormone receptor domain 0.0054
Further Details:      
 
Domain Number 3 Region: 236-339
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000293
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026251
Domain Number - Region: 758-845,918-934
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00863
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026251   Gene: ENSMMUG00000019963   Transcript: ENSMMUT00000028058
Sequence length 1317
Comment pep:known_by_projection chromosome:MMUL_1:5:17166962:17299149:-1 gene:ENSMMUG00000019963 transcript:ENSMMUT00000028058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPGRRRGRAQPPLLLQLSLLALLALLGGGGGAAALPAGCKHDGRPRGSGRAAGAAEGK
VVCSSLELAQVLPPDTLPNRTVTLTLFTNKITLKGQDLDISLYETLDLRNNLISSIDPGA
FWGLSSLKRLDLTNNRIGCLNADIFRGLTNLVRLNLSGNLFSSLSQGTFDYLASLRSLEF
QTEYLLCDCNILWMHRWVKERNITVRDTRCVYPKSLQAQPVTGVKQELLTCDPPLELPSF
YMTPSHRQVVFEGDSLPFQCMASYIDQDMQVLWYQDGRIVETDESQGIFVEKNMIHNCSL
IASALTISNIQAGSTGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGDFRWP
RTLAGITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVL
YMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGD
VMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEA
YVIKATGFTGMTCTVFQKVAASDRTGLSDYGRRDPDGNLDKQLSFKCNVSNTFSSLALKN
TIVEASIQLPPSLFSPKQKRELRPTDDSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRT
VVTPVILTKIDGVNVDTHHIPVNVTLRRIAHGADAVAARWDFDLLNGQGGWKSDGCHILY
SDENITTIQCYSLSNYAVLMDLTGSELYTQSASLLHPVVYTTAIILLLCLLAVIVSYIYH
HSLIRISLKSWHMLVNLCFHIFLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVG
VTARNIYKQVTKKAKRCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRP
NAPYCWMAWEPSLGAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAA
NENGEINHQDSMSLSLISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLD
LVFSFVFGATCLSFSAFFMVHHCVNREDVRLAWIMTCCPGRSSYSVQVNVQPPNSSGTNG
EASKCANSSAESSCTNKSASSFKNSSQGCKLTNLQAAAAQCHANSLPLNSTPQLDNSLTE
HSMDNDIKMHVAPLEVQFRTNVHSSRHHKNRSKGHRASRLTVLREYAYDVPTSVEGSVQN
GLPKSRLGNHEGHSRSRRAYLAYRERQYNRPQQDSSDACSTLPKSSRNFEKPVSTSSKKD
ALRKPAVVELENQQKSYGLNLAIQNGPIKSTGQEGSLLGTDSTGNVRTGLWKHETTV
Download sequence
Identical sequences ENSMMUP00000026251 9544.ENSMMUP00000026251 ENSMMUP00000026251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]