SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026309 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026309
Domain Number 1 Region: 303-605
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.07e-72
Family Protein kinases, catalytic subunit 0.000000484
Further Details:      
 
Domain Number 2 Region: 140-262
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-35
Family Kringle modules 0.00026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026309
Domain Number - Region: 34-121
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.016
Family Frizzled cysteine-rich domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026309   Gene: ENSMMUG00000020009   Transcript: ENSMMUT00000028121
Sequence length 687
Comment pep:known_by_projection chromosome:MMUL_1:15:103538858:103576285:-1 gene:ENSMMUG00000020009 transcript:ENSMMUT00000028121 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTITATGVLFVRLGPTHSPNHNFQDDYHEDGFCQPYRGIACARFIGNRTIYVDSLQMQG
EIENRITAAFTMIGTSTHLSDQCSQFAIPSFCHFVFPLCDARSRAPKPRELCRDECEVLE
SDLCRQEYTIARSNPLILMRLQLPKCEALPMPESPDAANCMRIGIPAERLGRYHQCYNGS
GTDYRGTASTTKSGHQCQPWALQHPHSHHLSSTDFPELGGGHAYCRNPGGQMEGPWCFTQ
NKNVRMELCDVPSCSPRDSSKMGILYILVPSIAIPLVIACLFFLVCMCRNKQKASASTPQ
RRQLMASPSQDMEMPLINQHKQAKLKEISLSAVRFMEELGEDRFGKVYKGHLFGPAPGEQ
TQAVAIKTLKDKAEGPLREEFRHEAMLRARLQHPNIVCLLGVVTKDQPLSMIFSYCSHSD
LHEFLVMRSPHSDVGSTDDDRTVKSALEPPDFVHLVAQIAAGMEYLSSHHVVHKDLATRN
VLVYDKLNVKISDLGLFREVYAADYYKLLGNSLLPIRWMAPEAIMYGKFSIDSDIWSYGV
VLWEVFSYGLQPYCGYSNQDVVEMIRNRQVLPCPDDCPAWVYALMIECWNEFPSRRPRFK
DIHSRLRAWGNLSNYNSSAQTSGASNTTQTSSLSTSPVSNAVRTRGSGRQCWTMEMPNAL
LWHNVSRVGSCWCLPGLADFKDEATDF
Download sequence
Identical sequences ENSMMUP00000026309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]