SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026483 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026483
Domain Number 1 Region: 2-404
Classification Level Classification E-value
Superfamily Sema domain 3.01e-156
Family Sema domain 0.0000000000714
Further Details:      
 
Domain Number 2 Region: 401-452
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000436
Family Plexin repeat 0.0021
Further Details:      
 
Domain Number 3 Region: 466-548
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000074
Family I set domains 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026483   Gene: ENSMMUG00000020117   Transcript: ENSMMUT00000028301
Sequence length 635
Comment pep:known_by_projection chromosome:MMUL_1:2:86141368:86147704:-1 gene:ENSMMUG00000020117 transcript:ENSMMUT00000028301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNFVKLLHAYNRTHLLACGTGAFHPTCAFVEVGHGAEEPVLRLDPGRIEDGKGKSPYDPR
HRAASVLVGEELYSGVAADLMGRDFTIFRSLGQRPSLRTEPHDSRWLNEPKFVKVFWIPE
NENPDDDKIYFFFRETAVEAAPALGRLSVSRVGQICRNDVGGQRSLVNKWTTFLKARLVC
SVPGVEGDTHFDQLQDVFLLSSRDHRTPLLYAVFSTSSIFQGSAVCVYSMNDVRRAFLGP
FAHKEGPMHQWVSYQGRVPYPRPGMCPSKTFGTFSSTKDFPDDVIQFARNHPLMYNSVLP
IGGRPLFLQVGANYTFTQIATDRVAAADGHYDVLFIGTDAGTVLKVISVPKGSRPSAEGL
LLEELHVFEDSAAVTSMQISSKRHQLYIASRSAVAQIALHRCAAHGRVCAECCLARDPYC
AWDGVACTRFQPSVKRRFRRQDVRNGDPSTLCSGDSSRPALLEHRVFGVEGSSAFLECEP
RSLQARVEWTFQRAGVTTHTQVLAQERTERTARGLLLRRLRRRDSGVYLCAAVEQGFTQP
LRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQP
ALQSLPPESRRKGRNRRTHAPEPRAERGPRSVTHW
Download sequence
Identical sequences ENSMMUP00000026483

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]