SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026902 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026902
Domain Number 1 Region: 345-518,547-608
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.29e-45
Family Voltage-gated potassium channels 0.0019
Further Details:      
 
Domain Number 2 Region: 612-745
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.52e-29
Family cAMP-binding domain 0.0014
Further Details:      
 
Domain Number 3 Region: 38-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.08e-21
Family Flavin-binding PAS domain 0.00000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026902   Gene: ENSMMUG00000020436   Transcript: ENSMMUT00000028750
Sequence length 830
Comment pep:known chromosome:MMUL_1:3:187894955:187923700:-1 gene:ENSMMUG00000020436 transcript:ENSMMUT00000028750 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVRRGHVAPQNTFLDTIIRKFEGQSRKFIIANARVENCAVIYCNDGFCELCGYSRAEVM
QRPCTCDFLHGPRTQRRAAAQIAQALLGAEERKVEIAFYRKDGSCFLCLVDVVPVKNEDG
AVIMFILNFEVVMEKDMVGTVSLASPRPVSESLALDEVTAMDNHVAGLGPAEERRALVGP
GSPPHSAPGPLPSPRAHSLNPDASGSSCSLARTRSRESCASVRRASSADDIEAMRAGALP
PPPRHASTGAMHPLRSGLLNSTSDSDLVRYRTISKIPQITLNFVDLKGDPFLASPTSDRE
IIAPKIKERTHNVTEKVTQVLSLGADVLPEYKLQAPRIHRWTILHYSPFKAVWDWLILLL
VIYTAVFTPYSAAFLLKETEEGPPATECGYACQPLAVVDLIVDIMFIVDILINFRTTYVN
ANEEVVSHPGRIAVHYFKGWFLIDMVAAIPFDLLIFGSGSEELIGLLKTARLLRLVRVAR
KLDRYSEYGAAVLFLLMCTFALIAHWLACIWYAIGNMEQPHMDSRIGWLHNLGDQIGKPY
NSSGLGGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTNSEKIFSICVMLIGSLMYASIFG
NVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWSYTNGIDMNAVL
KGFPECLQADICLHLNRSLLQHCKPFRGATKGCLRALAMKFKTTHAPPGDTLVHAGDLLT
ALYFISRGSIEILRGDVVVAILGMGWGAGTGLEMPSAASRGVSPLNMQSPGLWTWGCLQG
HWAPLIHLNSGPPSGTVKSSPTWGGAAELWGSHILPFRIHHKQTLFASLK
Download sequence
Identical sequences ENSMMUP00000026902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]