SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026911 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026911
Domain Number 1 Region: 44-283
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.86e-72
Family Alanine racemase-like, N-terminal domain 0.00000000066
Further Details:      
 
Domain Number 2 Region: 262-424
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 2.05e-49
Family Eukaryotic ODC-like 0.000000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026911   Gene: ENSMMUG00000020441   Transcript: ENSMMUT00000028759
Sequence length 461
Comment pep:novel chromosome:MMUL_1:13:10529207:10534035:-1 gene:ENSMMUG00000020441 transcript:ENSMMUT00000028759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFGNEEFDCHFLDEGFTAKDILDQKINEVSFSDDKDAFYVADLGDILKKHLRWLKALP
RVTPFYAVKCNDSKAIVKTLAAVGTGFDCASKTEIQLVQNLGVPPERIIYANPCKQVSQI
KYAANNGVQMMTFDSEVELMKVTRAHPKAKLVLRIATDDSKAVCRLSVKFGATLRNSRLL
LERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPG
SEEVKLKFEEITNVINPALDKYFPADSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ
TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTC
DGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQF
QNPDFPPEVEEQDASTLPVSCAWESGMKRHPAACASAGINV
Download sequence
Identical sequences F6W7N2
9544.ENSMMUP00000026911 NP_001185615.1.72884 XP_014967125.1.72884 XP_014967126.1.72884 ENSMMUP00000026911 ENSMMUP00000026911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]