SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027105 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027105
Domain Number 1 Region: 26-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.000000554
Further Details:      
 
Domain Number 2 Region: 135-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000678
Family EGF-type module 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027105   Gene: ENSMMUG00000007459   Transcript: ENSMMUT00000028968
Sequence length 185
Comment pep:known chromosome:MMUL_1:1:14152681:14155145:-1 gene:ENSMMUG00000007459 transcript:ENSMMUT00000028968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGHESTDTERAPGNDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPACDHHCHNHLGGFYCSCRVGYILHRNKRTC
SEQSL
Download sequence
Identical sequences A0A2K5UK03 A0A2K6DPW0
XP_005544871.1.63531 XP_011725083.1.29376 XP_014966381.1.72884 ENSMMUP00000027105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]