SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027180 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027180
Domain Number 1 Region: 1-98
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 1.86e-42
Family MHC antigen-recognition domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 101-193
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-32
Family C1 set domains (antibody constant domain-like) 0.0000166
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027180   Gene: ENSMMUG00000032619   Transcript: ENSMMUT00000029052
Sequence length 255
Comment pep:known scaffold:MMUL_1:1099214729327:5003:7829:1 gene:ENSMMUG00000032619 transcript:ENSMMUT00000029052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YYNQSEAGSHTFQRVYGCDLGPDGLLLRGYYQFAYDGKDYIALNEDLQSWTAADEAAQNT
QRKWEAAGVAEQLRAHLEGPCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRC
WALGFYPAEITLTWQRDGEEQTQDTELVETRPGGDGTFQKWGAVVVPSGEEQRYTCHVQH
EGLPEPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVTGAVVAAVMWRRKSSGGKGGSYSQA
ASSDSAQGSDVSLTA
Download sequence
Identical sequences ENSMMUP00000027180 ENSMMUP00000027180 9544.ENSMMUP00000027180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]