SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027271 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027271
Domain Number 1 Region: 18-154
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-25
Family C-type lectin domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027271   Gene: ENSMMUG00000020720   Transcript: ENSMMUT00000029146
Sequence length 232
Comment pep:known chromosome:MMUL_1:12:23326736:23347494:-1 gene:ENSMMUG00000020720 transcript:ENSMMUT00000029146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLAAPPALLLPLLGLAAAAVADCPSSTWIQFQDNCYIFLQEAIKVESIEDVRNQCTDHG
ADMISIHNEEENAFILDTLKKQWKGSDDILLGMFYDTDDASFKWFDNSNMTFDKWTDQDD
GEDLIDTCAFLHIKTGEWKKGNCEVSFVEGTLCKTAIPYKRKYLSDNHILISALVIASIV
ILTVLGAIIWFLYKKHSDSRFTTVFSTAPQSPYNEDCVLVVGEENEYPVQFE
Download sequence
Identical sequences A0A2K5TKK5
XP_005573315.1.63531 XP_014965710.1.72884 9544.ENSMMUP00000027271 ENSMMUP00000027271 ENSMMUP00000027271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]