SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027272 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027272
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 6.92e-34
Family C-type lectin domain 0.00076
Further Details:      
 
Domain Number 2 Region: 350-487
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-33
Family C-type lectin domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1371-1515
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-28
Family C-type lectin domain 0.0022
Further Details:      
 
Domain Number 4 Region: 949-1092
Classification Level Classification E-value
Superfamily C-type lectin-like 1.31e-27
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 5 Region: 1525-1662
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-27
Family C-type lectin domain 0.00068
Further Details:      
 
Domain Number 6 Region: 1107-1223
Classification Level Classification E-value
Superfamily C-type lectin-like 2.75e-26
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 7 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2.23e-25
Family Cysteine rich domain 0.01
Further Details:      
 
Domain Number 8 Region: 634-792
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-25
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 9 Region: 501-627
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-19
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 10 Region: 1239-1359
Classification Level Classification E-value
Superfamily C-type lectin-like 8.75e-18
Family C-type lectin domain 0.0059
Further Details:      
 
Domain Number 11 Region: 818-932
Classification Level Classification E-value
Superfamily C-type lectin-like 2.1e-16
Family C-type lectin domain 0.018
Further Details:      
 
Domain Number 12 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 0.00000000000000628
Family Fibronectin type II module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027272   Gene: ENSMMUG00000020721   Transcript: ENSMMUT00000029147
Sequence length 1722
Comment pep:known chromosome:MMUL_1:12:23352648:23446699:-1 gene:ENSMMUG00000020721 transcript:ENSMMUT00000029147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTDWATPRRPAGLLMLLLWCFELAEPSGRAANDPFTIVHGNTGKCIKPVYGWIVAEDCD
ETEDKLWKWVSQHRLFHLHSQKCLGLDITKSVNEVRMFSCDSSVMLWWKCEHHSLYSAAR
YQLALKNGHGAAISNASDIWKKGGSEESLCDQPYHEIYTRDGNSYGRPCEFPFLVDGTWH
HDCILDEDHSGPWCATTLNYEYDRMWGICLKPENGCEDNWEKNEQFGSCYQFNTQTALSW
KEAYVSCQNQGADLLSINSAAELTYLKEKEGIAKIFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDRPSAPTIGGSSCARMDAESGLWQSFSCDAQLPYVCRKPLNNTVELTDVWTYSDTR
CDAGWLPNNGFCYLLVNESNSWDKAHAKCKDFSGDLISIHSLADVEVVVTKLHNEDTKEE
VWIGLKNINIPTLFQWSDGTEVTLTYWDENEPNVPYNKTPNCVSYLGELGQWKVQSCEEK
LKYVCKRKGEKLNDTSSDKMCPPNEGWKRHGETCYKIYEDEVPFGTNCNLTITSRFEQEY
LNDLMKKYDKSLRKYFWTGLRDVDSRGEYNWATVGGTRRSVTFSNWNFLEPASPGGCVAM
STGKSLGKWEVKDCRSFKALSICKKMSGPLEPEEAAPKPDDPCPEGWQSFPTSLSCYKVF
HAERIVRKRNWEEAERFCQALGAHLSSFSRVDEIKEFLHFLTDQFSGQRWLWIGLNKRSP
DLQGSWQWSDRTPVSTIIMPNEFQQDYDIRDCAAVKVFHRPWRRGWHFYDDREFIYLRPF
ACDTKLEWVCQIPKGRTPKTPDWYNPERAGIHGPPLIIEGSEYWFVADLHLNYEEAVLYC
ASNHSFLATITSFAGLKAIKNKIANISGDGQKWWIRINEQPIDDHFTYSRYPWHRFHVTF
GEECLYMSAKTWLIDLSKPTDCNTKLPFICEKYNVSSLEKYSPDSAAKVQCSEQWIPFQN
KCFLKIKPMSLTFSQASDTCHSYGGTLPSVLSQIEQDFITSLLPDMEATLWIGLRWTAYE
RINKWTDNRELTYSNFHPLLFSRRLRIPENLFEEESHYHCALILNLQKSPFIGTWNFTSC
SERHFVSLCQKYSEVKGRQTLQNASETVKYLNNLYKIIPKTLTWHGAQKECLKNNMQLVS
ITDPYQQAFLSVQALLHNSSLWIGLFSQDDELNFGWSDGKRLHFSRWAETNGQLEDCVIL
DTDGFWKTADCNDNQPGAICYYSGNETEKEVKPVDSVKCPSPVLNTPWIPFQNCCYNFII
TKNRHMATTLDEVHSKCQKLNPKSQILSIRDEKENNFVLEQLLYFNYMASWVTLGITYEN
NSLMWFDKTPLSYTHWRAGRPTIKNEKFLAGLSTDGFWDIKTFNVIEETLYFHQHSILAC
KIEMVDYKEEYNTTLPQFMPYEDGIYSVIQKKVTWYEALNMCSQSGGHLASVHDQNGQLF
LEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSIFDYIPWKGQTSPGNCVLLDPKGTWKHE
KCNSVKDGAICYKPTKSKKLSHLTYSSRCPTVKENGSRWIQYKGHCYTSDQALHSFSEAK
KLCSKHGQSATIVSIKDEDENKFVSRLMRENNNITMRVWLGLSQHSVDQSWSWLDGSEVT
FVKWENKSKSGIGKCSMLIASNETWKNVECEHGFGRVVCKMPLGPDYTSIAIAVATLSIL
VLMGVLIWFVFQRHRLHLAGFSAVRYAQGVNEDEIMLPSFHD
Download sequence
Identical sequences XP_001093552.1.72884 ENSMMUP00000027272 9544.ENSMMUP00000027272 ENSMMUP00000027272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]