SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027274 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027274
Domain Number 1 Region: 377-507
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-33
Family C-type lectin domain 0.00097
Further Details:      
 
Domain Number 2 Region: 1243-1385
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-31
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 3 Region: 230-364
Classification Level Classification E-value
Superfamily C-type lectin-like 5.64e-31
Family C-type lectin domain 0.00084
Further Details:      
 
Domain Number 4 Region: 810-942
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-29
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 5 Region: 1120-1243
Classification Level Classification E-value
Superfamily C-type lectin-like 1.15e-28
Family C-type lectin domain 0.0016
Further Details:      
 
Domain Number 6 Region: 957-1103
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-26
Family C-type lectin domain 0.00054
Further Details:      
 
Domain Number 7 Region: 662-803
Classification Level Classification E-value
Superfamily C-type lectin-like 8.33e-26
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 8 Region: 40-165
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.11e-23
Family Cysteine rich domain 0.013
Further Details:      
 
Domain Number 9 Region: 513-649
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-21
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 10 Region: 186-224
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000514
Family Fibronectin type II module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027274   Gene: ENSMMUG00000020722   Transcript: ENSMMUT00000029149
Sequence length 1466
Comment pep:known chromosome:MMUL_1:12:23485296:23603319:-1 gene:ENSMMUG00000020722 transcript:ENSMMUT00000029149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLSPSLLLLLLLLLLGAPRGYAEDVAAALTPERLLEWRDKGLFIIQSESLKKCIQAGKS
VLTLENCKQANKHMLWKWVSNHGLFNIGGSGCLGLNFSAPEQPLSLYECDSTLISLRWRC
NRKMITGPLQYSVQVAHDNTVVASRKYFHKWISYVSGGGDICEYLHKGKNNLKKHSGNSI
FLKVMRYNHQWHHECTREGREDDLLWCATTSRYERDEKWGFCPDPTSAEVSCDTIWEKDL
NSHICYQFNLLSSLSWSEAHSSCQMQGGALLSITDETEENFVREHMSSKAVEVWIGLNQL
DEHAGWQWSDGTPLNYLNWSPDVNFEPFVENHCGTFSSFMPSAWRSRDCESTLPYICKKY
LNHTDHEIVEKDAWKYYATHCEPGWNPYNRNCYKLQKEEKTWHKALRSCQADNSALIDIT
SLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSSDSSVIFTNWHTLEPQIFPNRSQL
CVSAEQSEGHWKVKNCEETLFYICKKAGHVLSDAESGCQEGWERHGGFCYKIDTVLRSFD
QASSGYYCPPALVSISFLFEQAFITSLISSVVKMKDSYFWIALQDQNDTGEYTWKPAGRK
PEPVQYTHWNTHQPSYSGGCVAMRGKHPLGSWEVKDCRHFKAMSLCKQPVENQETTEHEE
RWPFHPCYLDWESEPGLASCFKVFHSEKVLTKRTWREAEAFCEEFGAHLASFAHIEEENF
VNELLHSKFNWTEARQFWIGFNKRNPLNAGSWEWSDRTPVVSSFLDNNYFGEDARNCAVY
KANKTLLPLHCGSKREWICKIPRDVKPKIPFWYQYDVPWLFYQDAEYLFHTFASEWSNFG
FVCSWLHSDLLTIHSAHEQEFIHSKIKALSKYGASWWIGLQEEGANDEFRWRDGTPVIYQ
NWDTGRERTVNNQSQRCGFISSVTGLWGSEECSVSMPSICKRKKVWLIEKKKDTPKQHGT
CPKGWLYFNYKCLLLNIPKDPSSWKNWTHAQHFCAEEAGTLVAIESEVEQAFITMNLFGQ
TTNVWIGLQNDDYETWLNGKPVVYSNWSPFDTINIPNHSTTEVQKHIPLCALLSSNPNFH
FTGKWYFEDCGKEGYGFVCEKMQDTSGRGVNTSDMYPMPNTLEYGNRTYKIINANMTWYA
AIKTCLMHGAQLVSITDQYHQSFLTVVLNRLGYAHWIGLFTTDNGLNFDWSDGTKSSFTF
WKDEESSLHGDCVFADTNGRWHSTACESFLQGAICHVPPETRPSEHPELCSETSIPWIKF
KSNCYSFSTVLDSMSFEAAHEFCKKEGSNLLTIKDEAENAFLLEELFAFGSSVQMVWLNA
QFDGNNETIKWFDGTPTDQSNWGIRKPDTDYFKPHHCVALRIPEGLWQLSPCQEKKGFIC
KMKADIRTAEELPEKGPSHSIIPLVVVLTLIVTVAICTLSFCIYKQNGGFFGRLAGFQNP
YYPATNFSTVHLEENILISDLEKSDQ
Download sequence
Identical sequences ENSMMUP00000027274 9544.ENSMMUP00000027274 ENSMMUP00000027274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]