SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027423 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027423
Domain Number 1 Region: 260-365
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.33e-20
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.00000173
Further Details:      
 
Domain Number 2 Region: 921-967
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 0.00000000000000235
Family Nuclear receptor coactivator interlocking domain 0.0001
Further Details:      
 
Domain Number 3 Region: 120-184
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000314
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.031
Further Details:      
 
Domain Number 4 Region: 14-87
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000366
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027423   Gene: ENSMMUG00000020838   Transcript: ENSMMUT00000029310
Sequence length 1441
Comment pep:known_by_projection chromosome:MMUL_1:13:24573065:24688817:1 gene:ENSMMUG00000020838 transcript:ENSMMUT00000029310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSGSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLTTRPRMPNNSFPPNISTLSSPVGMTSSACNNNTNRSYSNIPVT
SLQGMNEGPNNSVGFSANSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSD
NSSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLS
CTGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSV
SVTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKE
QMDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGA
VTSVTIKSEILPASLQSATARPTSRLNSIILSLTSITQILGLRVKYLFINASINNKTVIF
RHSETFFQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDK
LVQGGGLDVLSERFPPQQATPPLMMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLG
TMPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQ
FAATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQS
FGNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLA
NRNSMVSRGMTGNMGGQFGTGINPQIQQNVFQYPGAGMVPQGEASFAPSLSPGSSMVPMP
IPPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNVFSQAVQNQSTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E
Download sequence
Identical sequences ENSMMUP00000027423 9544.ENSMMUP00000027423 ENSMMUP00000027423

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]