SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027444 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027444
Domain Number 1 Region: 510-545
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000154
Family C-type lectin domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027444
Domain Number - Region: 119-287
Classification Level Classification E-value
Superfamily Tropomyosin 0.00392
Family Tropomyosin 0.019
Further Details:      
 
Domain Number - Region: 222-432
Classification Level Classification E-value
Superfamily Tropomyosin 0.0353
Family Tropomyosin 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027444   Gene: ENSMMUG00000020854   Transcript: ENSMMUT00000029331
Sequence length 585
Comment pep:known_by_projection chromosome:MMUL_1:13:71116748:71127215:-1 gene:ENSMMUG00000020854 transcript:ENSMMUT00000029331 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGEAVRFCTDNQCVSLHPRGVDSVATASAAPKIPRLIQATPAFMAVTLVFSLVTLFVVV
QQHTRPVPKPVQAMILGDNITGHLPFEPNNHHHFGREAEMQELIQILKGHMENSSTWVAE
IQMLRCRVDNVNLQLQLLDDHLGNTSADIQMVKGVLKDATTLSLQTQMLRSSLEGTNAEI
QRLKGGLEKADALTFRTQNFLKSSLENTSIELHMLSRGLENANSEIQMLNASLEMANAQA
RLANSSLKNANAEIHVLRGHLDRVNDLRTQSQVLRSSLEGANAEIQGLKENLQNTNALNS
QTQAFIKGSFDNTSAEIQFLRGHLERAGDEIHMLKRDLETVTAQTQKANGRLDQTDAQIQ
VFKAEMENANTLNAQIRVLNGHKKNASREMQTLKQEMKNASALTSQTQMLDSNLQKASAE
ILRLRGDLENTKALTMEIQQEQSRLKTLHKVVASQEQLQRIQSKWEWRVPLGRAQSLERV
ESPASSASFLPQHASPGPNPRKWARRAWAAFLVEVTGQAYYWIGLTDRGTEGSWCWTDGT
PFNVAQNKTPGSKGPCPLRRHISVNSGVGACSFIDTPPCPWILSN
Download sequence
Identical sequences 9544.ENSMMUP00000027444 ENSMMUP00000027444 ENSMMUP00000027444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]