SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027625 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027625
Domain Number 1 Region: 111-231
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-33
Family Cadherin 0.0012
Further Details:      
 
Domain Number 2 Region: 220-325
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-29
Family Cadherin 0.00054
Further Details:      
 
Domain Number 3 Region: 321-436
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-25
Family Cadherin 0.0015
Further Details:      
 
Domain Number 4 Region: 14-115
Classification Level Classification E-value
Superfamily Cadherin-like 5.63e-23
Family Cadherin 0.0012
Further Details:      
 
Domain Number 5 Region: 429-531
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000131
Family Cadherin 0.01
Further Details:      
 
Domain Number 6 Region: 697-728
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000203
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027625
Domain Number - Region: 676-701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000256
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027625   Gene: ENSMMUG00000020993   Transcript: ENSMMUT00000029522
Sequence length 731
Comment pep:novel chromosome:MMUL_1:10:90485549:90566780:-1 gene:ENSMMUG00000020993 transcript:ENSMMUT00000029522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSTSVSITVLDVNDNDPVFTQPTYELRLNEDAAVGSSVLTLQARDRDANSVITYQLTG
GNTRNRFALSSQRGGGLITLALPLDYKQEQQYVLAVTASDGTRSHTAHVLINVTDANTHR
PVFQSSHYTVSVSEDRPVGTSIATLSANDEDTGENARITYVIQDPVPQFRIDPDSGTMYT
MMELDYENQVAYTLTIMAQDNGIPQKSDTTTLEILILDANDNAPQFLWDFYQGSIFEDAP
PSTSILQVSATDRDSGPNGRLLYTFQGGDDGDGDFYIEPTSGVIRTQRRLDRENVAVYNL
WALAVDRGSPTPLSASVEIQVTILDINDNAPMFEKDELELFVEENNPVGSVVAKIRANDP
DEGPNAQIMYQIVEGDMRHFFQLDLLNGDLRAMVELDFEVRREYVLVVQATSAPLVSRAT
VHILLVDQNDNPPVLPDFQILFNNYVTNKSNNFPTGVIGRIPAHDPDVSDSLNYTFLQGN
ELRLLLLDPATGELQLSRDLDNNRPLEALMEVSVSDGIHSVTAFCTLRVTIITDDMLTNS
ITVRLENMSQEKFLSPLLALFVEGVAAVLSTTKDDVFVFNVQNDTDVSSNILNVTFSALL
PGGVRGQFFPSEDLQEQIYLNRTLLTTISTQRVLPFDDNICLREPCENYMKCVSVLRFDS
SAPFLSSTTVLFRPIHPINGLRCRCPPGFTGDYCETEIDLCYSNPCGANGRCRSREGGYT
CECFQDFTEIS
Download sequence
Identical sequences ENSMMUP00000027625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]