SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027723 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027723
Domain Number 1 Region: 99-193
Classification Level Classification E-value
Superfamily SRCR-like 1.23e-37
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00022
Further Details:      
 
Domain Number 2 Region: 13-58
Classification Level Classification E-value
Superfamily SRCR-like 0.00000144
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027723   Gene: ENSMMUG00000021065   Transcript: ENSMMUT00000029623
Sequence length 194
Comment pep:known_by_projection chromosome:MMUL_1:3:49981053:49984492:1 gene:ENSMMUG00000021065 transcript:ENSMMUT00000029623 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTLRTRAWPAVRRAAGPRWAPRAWATSATAAAPDCFHLGWGQHNCGHHEDAGALCAVG
PTSHSPEELGLQVQQDGSETTRVPTPRPRDGRERADIKHPAHGRVELYLGQRWGTVCDDA
WDLRAAGVLCRQLGCGQALAAPGEAHFGPGRGPILLDNVKCRGEESALLLCSHIRWDAHN
CDHSEDAGVLCQPS
Download sequence
Identical sequences ENSMMUP00000027723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]