SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027826 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027826
Domain Number 1 Region: 521-628
Classification Level Classification E-value
Superfamily SRCR-like 1.12e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000376
Further Details:      
 
Domain Number 2 Region: 392-500
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 3 Region: 262-370
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000376
Further Details:      
 
Domain Number 4 Region: 1036-1142
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000403
Further Details:      
 
Domain Number 5 Region: 907-1011
Classification Level Classification E-value
Superfamily SRCR-like 5.23e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 
Domain Number 6 Region: 6-111
Classification Level Classification E-value
Superfamily SRCR-like 7.85e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000636
Further Details:      
 
Domain Number 7 Region: 778-882
Classification Level Classification E-value
Superfamily SRCR-like 1.15e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 8 Region: 132-238
Classification Level Classification E-value
Superfamily SRCR-like 2.75e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000432
Further Details:      
 
Domain Number 9 Region: 649-755
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-43
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000614
Further Details:      
 
Domain Number 10 Region: 1408-1515
Classification Level Classification E-value
Superfamily SRCR-like 4.19e-42
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 11 Region: 1166-1267
Classification Level Classification E-value
Superfamily SRCR-like 8.63e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00012
Further Details:      
 
Domain Number 12 Region: 1290-1402
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.18e-34
Family Spermadhesin, CUB domain 0.0003
Further Details:      
 
Domain Number 13 Region: 1532-1587
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.71e-16
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027826   Gene: ENSMMUG00000021138   Transcript: ENSMMUT00000029732
Sequence length 1587
Comment pep:known_by_projection chromosome:MMUL_1:9:122218018:122265551:1 gene:ENSMMUG00000021138 transcript:ENSMMUT00000029732 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSDYDLALRLVNGDGRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGN
AWFGQGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCGHSEDAGVICSGGHQRSLEEMDE
GFLCSPVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLRCGW
ATSAPGNARFGQGSGPIVLDDVRCSGQESYLWSCPHNGWLSHNCGHSEDAGVICSGGSPR
PWAPSLGMDEGFFCSPVGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDAS
VVCRQLGCGWATSAPGSARFGQGSGPIVLDDVRCSGNESYLWNCPHNGWLSHNCGHHEDA
GVICTGGSPRLWVSSLGMDEEFLCSPVGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVC
DDSWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESHLWNCPHNGWL
SHNCGHSEDAGVICSGGSPRLWVSSRIAEGFLCSPVGPESSLALRLVNGGDRCQGRVEVL
YRGSWGTVCDDSWDINDASVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGDESYL
WNCPHNGWLSHNCGHSEDAGVICSGGSPRLVSSRMDEGFLCSPVGSESSLALRLVNGSDR
CQGRVEVLFGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLHDVRC
SGHESYLWSCPHRGWLSHNCGHHEDAGVICSGGPPRPWVPSPNTWLTSPASTAGSESSLA
LRLVNGGDRCQGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGS
GPIVLDDMRCSGHESYLWNCPHRGWLSHNCGHHEDAGVICSAAQSQSTPRPGESPASFLG
IVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAP
GNARFGQGSGPIVLDDVRCSGQESYLWNCPHRGWLSHNCGHHEDAGVICSAAQSQSTPRP
GESPASFLGIVGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQL
GCGWATSAPGNARFGQGSGPIVLDDVRCSGQESYLWNCPHRGWLSHNCGHHEDAGVICSG
GSPRLSRPKSGLPLIFLSLLESNSGVALRLVNGGDRCQVEVLYQGSWGTMCDDSWDTNDA
NVVCRQLGCGWAMSAPGNAQFGQGSGPIVLDDVRCSGNKSYLWSCPHNDWLSHSCQHSEA
TVICSATQINSTVSDWWHPTTTITTRPSSNCGGFLFSASGTFSSPSYPAYYPNNAKCVWE
IEVNSGYRINLGFSNLQLEAHYNCSFDYVEIFDGSLNSSHLLGKICNDTRQIFTSSYNRM
TIHFRSDISFQNTGFLAWYNSFPSDATLRLVNLNSSYGLCAGRVEIYHGGTWGTVCDDSW
TIHEAEVVCRQLGCGRAVSALGNAYFGAGSGPITLDDVECSGSESTLWQCRNRGWFSHNC
RHNEDAGVICSGMAQCHAAPFLNVTPPNTNYSCGGFLSQPSGDFSSPFYPGNYPNNAKCV
WDIEVQNNHRVTVVFRDVQLEGGCNYD
Download sequence
Identical sequences ENSMMUP00000027828 9544.ENSMMUP00000027826 ENSMMUP00000027826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]