SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027829 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027829
Domain Number 1 Region: 433-539
Classification Level Classification E-value
Superfamily SRCR-like 9.81e-47
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 325-430
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 3 Region: 217-322
Classification Level Classification E-value
Superfamily SRCR-like 2.88e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000376
Further Details:      
 
Domain Number 4 Region: 778-883
Classification Level Classification E-value
Superfamily SRCR-like 3.53e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 
Domain Number 5 Region: 670-775
Classification Level Classification E-value
Superfamily SRCR-like 1.01e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 6 Region: 3-105
Classification Level Classification E-value
Superfamily SRCR-like 3.01e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000636
Further Details:      
 
Domain Number 7 Region: 109-214
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000432
Further Details:      
 
Domain Number 8 Region: 886-989
Classification Level Classification E-value
Superfamily SRCR-like 5.75e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000403
Further Details:      
 
Domain Number 9 Region: 549-642
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027829   Gene: ENSMMUG00000021138   Transcript: ENSMMUT00000029735
Sequence length 989
Comment pep:known_by_projection chromosome:MMUL_1:9:122218030:122251127:1 gene:ENSMMUG00000021138 transcript:ENSMMUT00000029735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLALRLVNGDGRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGNAWFG
QGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCGHSEDAGVICSGSESSLALRLVNGGDR
CQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLRCGWATSAPGNARFGQGSGPIVLDDVR
CSGQESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGS
WGTVCDDSWDTNDASVVCRQLGCGWATSAPGSARFGQGSGPIVLDDVRCSGNESYLWNCP
HNGWLSHNCGHHEDAGVICTGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTN
DANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESHLWNCPHNGWLSHNCGHS
EDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDINDASVVCRQLGCG
WATSAPGNARFGQGSGPIVLDDVRCSGDESYLWNCPHNGWLSHNCGHSEDAGVICSDFEE
FREKNERQRPCSGRKSERTTGSWGTVCDDSWDTSDANVVCRQLGCGWATSAPGNARFGQG
SGPIVLHDVRCSGHESYLWSCPHRGWLSHNCGHHEDAGVICSVVDSETPKTCKGKVLHSQ
TTPIPGSESSLALRLVNGGDRCQGRVEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWAT
SAPGNARFGQGSGPIVLDDMRCSGHESYLWNCPHRGWLSHNCGHHEDAGVICSGSESSLA
LRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGS
GPIVLDDVRCSGQESYLWNCPHRGWLSHNCGHHEDAGVICSGSESSLALRLVNGGDRCQG
RVEVLYRGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSG
QESYLWNCPHRGWLSHNCGHHEDAGVICS
Download sequence
Identical sequences ENSMMUP00000027829

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]