SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027830 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027830
Domain Number 1 Region: 325-430
Classification Level Classification E-value
Superfamily SRCR-like 2.09e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000424
Further Details:      
 
Domain Number 2 Region: 217-322
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000376
Further Details:      
 
Domain Number 3 Region: 808-913
Classification Level Classification E-value
Superfamily SRCR-like 3.66e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 
Domain Number 4 Region: 433-536
Classification Level Classification E-value
Superfamily SRCR-like 7.19e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000376
Further Details:      
 
Domain Number 5 Region: 700-805
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 6 Region: 3-106
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000636
Further Details:      
 
Domain Number 7 Region: 109-214
Classification Level Classification E-value
Superfamily SRCR-like 4.71e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000432
Further Details:      
 
Domain Number 8 Region: 916-1019
Classification Level Classification E-value
Superfamily SRCR-like 6.02e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000403
Further Details:      
 
Domain Number 9 Region: 573-672
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027830   Gene: ENSMMUG00000021138   Transcript: ENSMMUT00000029736
Sequence length 1019
Comment pep:known_by_projection chromosome:MMUL_1:9:122218030:122251127:1 gene:ENSMMUG00000021138 transcript:ENSMMUT00000029736 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLALRLVNGDGRCQGRVEVLYQGSWGTVCDDSWDTNDANVVCRQLGCGWAMLAPGNAWFG
QGSGPIVLDDVRCSGYESYLWSCPHNGWLSHNCGHSEDAGVICSGSESSLALRLVNGGDR
CQGRVEVLYRGSWGTVCDDSWDTSDANVVCRQLRCGWATSAPGNARFGQGSGPIVLDDVR
CSGQESYLWSCPHNGWLSHNCGHSEDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGS
WGTVCDDSWDTNDASVVCRQLGCGWATSAPGSARFGQGSGPIVLDDVRCSGNESYLWNCP
HNGWLSHNCGHHEDAGVICTGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTN
DANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGYESHLWNCPHNGWLSHNCGHS
EDAGVICSGPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDINDASVVCRQLGCG
WATSAPGNARFGQGSGPIVLDDVRCSGDESYLWNCPHNGWLSHNCGHSEDAGVICSADSG
TAKTYLLSTSTLPASTVGMDEGFLCSPVGSESSLALRLVNGSDRCQGRVEGSWGTVCDDS
WDTSDANVVCRQLGCGWATSAPGNARFGQGSGPIVLHDVRCSGHESYLWSCPHRGWLSHN
CGHHEDAGVICSVVDSETPKTCKGKVLHSQTTPIPGSESSLALRLVNGGDRCQGRVEVLY
QGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDMRCSGHESYLW
NCPHRGWLSHNCGHHEDAGVICSGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSW
DTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDVRCSGQESYLWNCPHRGWLSHNC
GHHEDAGVICSGSESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDYWDTNDANVVCRQL
GCGWATSAPGNARFGQGSGPIVLDDVRCSGQESYLWNCPHRGWLSHNCGHHEDAGVICS
Download sequence
Identical sequences ENSMMUP00000027830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]