SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027831 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027831
Domain Number 1 Region: 128-234
Classification Level Classification E-value
Superfamily SRCR-like 2.62e-47
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000369
Further Details:      
 
Domain Number 2 Region: 418-522
Classification Level Classification E-value
Superfamily SRCR-like 1.83e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 
Domain Number 3 Region: 285-388
Classification Level Classification E-value
Superfamily SRCR-like 5.36e-46
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000479
Further Details:      
 
Domain Number 4 Region: 1-103
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-45
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000417
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027831   Gene: ENSMMUG00000021138   Transcript: ENSMMUT00000029737
Sequence length 523
Comment pep:known_by_projection chromosome:MMUL_1:9:122227772:122241246:1 gene:ENSMMUG00000021138 transcript:ENSMMUT00000029737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGS
GPIVLDDVRCSGYESHLWNCPHNGWLSHNCGHSEDAGVICSDCYGQTQSPSNTPRCVRAP
STSRPESSLALRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDINDASVVCRQLGCGWATSA
PGNARFGQGSGPIVLDDVRCSGDESYLWNCPHNGWLSHNCGHSEDAGVICSDLLSTSTLP
ASTDKPWRAPYSWDLIPSPLAMHCRPARMDTWLTSPASTAGSESSLALRLVNGGDRCQGR
VEVLYQGSWGTVCDDYWDTNDANVVCRQLGCGWATSAPGNARFGQGSGPIVLDDMRCSGH
ESYLWNCPHRGWLSHNCGHHEDAGVICSVPDHLGQGLEMGSQLTAQSQSTPRPGSESSLA
LRLVNGGDRCQGRVEVLYRGSWGTVCDDSWDTNDANVVCRQLGCGWATSAPGNARFGQGS
GPIVLDDVRCSGQESYLWNCPHRGWLSHNCGHHEDAGVICSGG
Download sequence
Identical sequences ENSMMUP00000027831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]