SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027869 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000027869
Domain Number - Region: 32-88
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0366
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027869   Gene: ENSMMUG00000005283   Transcript: ENSMMUT00000029777
Sequence length 108
Comment pep:known chromosome:MMUL_1:1:197951065:197961608:1 gene:ENSMMUG00000005283 transcript:ENSMMUT00000029777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKLKKVLSGQDTEDRSGLSEVVEASSLSWGTRIKGFIACFAIGILCSLLGTLLLWVPRK
GLHLFAVFYTFGNIASIGSCVLHLPCVLPFGGITRDLHLSSAFCSLWH
Download sequence
Identical sequences A0A2I3MK62 A0A2K5W539 F7H8M3
ENSMMUP00000027869

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]