SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027909 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027909
Domain Number 1 Region: 2-151
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-32
Family WD40-repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027909   Gene: ENSMMUG00000032034   Transcript: ENSMMUT00000029821
Sequence length 168
Comment pep:novel chromosome:MMUL_1:11:36139955:36156073:-1 gene:ENSMMUG00000032034 transcript:ENSMMUT00000029821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGSRDNGIK
KWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVGEMKGHD
SPINAICVNSTHIFTAADDRTVRIWKARNLQDGQISDTGDLGEDTASN
Download sequence
Identical sequences ENSMMUP00000027909 ENSMMUP00000027909 9544.ENSMMUP00000027909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]