SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027948 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027948
Domain Number 1 Region: 107-214
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-20
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0088
Further Details:      
 
Domain Number 2 Region: 254-289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 3 Region: 219-252
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 43-103
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000188
Family Ovomucoid domain III-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027948   Gene: ENSMMUG00000021226   Transcript: ENSMMUT00000029865
Sequence length 291
Comment pep:novel chromosome:MMUL_1:5:102659235:102672821:-1 gene:ENSMMUG00000021226 transcript:ENSMMUT00000029865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGLLPALILFLLESCRVTSTFQEDRVEKKCLAKKYTHLSCNKVFCQPWQRCIEGTCVCKL
PYQCPKNGTVVCATNGRSFPTYCQQKSLECLRPGTKFLNNGTCIAGGKFSVSLKHGNTDS
EGIVEVKLVDQDKAMFVCKSSWSMREANVACLDLGFQQGADSERFKLSDLSINSTECLHV
HCRGLETSLAECTFTKRRTMDYQDLADVVCYTQKADSPTNDSFQCVNGKYISQTKACDGI
NDCGDQSDELCCKACHGRSFHCKSDVCIPSQYRCNGEVDCITGDDEVGCEG
Download sequence
Identical sequences ENSMMUP00000027948 9544.ENSMMUP00000027948 ENSMMUP00000027948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]