SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028006 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028006
Domain Number 1 Region: 60-148
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 8.63e-37
Family Small-conductance potassium channel 0.0000756
Further Details:      
 
Domain Number 2 Region: 10-68
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000157
Family Voltage-gated potassium channels 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028006   Gene: ENSMMUG00000021267   Transcript: ENSMMUT00000029926
Sequence length 200
Comment pep:known_by_projection chromosome:MMUL_1:19:50232487:50237573:-1 gene:ENSMMUG00000021267 transcript:ENSMMUT00000029926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQAVNATGHLSDTLWLIPITFLTIGYGDVVPGTMWGKIVCLCTGVMGVCCTALLVAVVAR
KLEFNKAEKHVHNFMMDIQYTKEMKESAARVLQEAWMFYKHTRRKESRAARRHQRRLLAA
INAFRQVRLKHRKLQEQVNSMVDISKMHMILYDLQQNLSSSHRALEKQIDTLAGKLDALT
ELLSTALGPRQLPEPSQQST
Download sequence
Identical sequences ENSMMUP00000028006 9544.ENSMMUP00000028006 ENSMMUP00000028006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]