SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028081 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028081
Domain Number 1 Region: 486-630
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 2.22e-51
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000153
Further Details:      
 
Domain Number 2 Region: 132-330
Classification Level Classification E-value
Superfamily Radical SAM enzymes 3.92e-45
Family MoCo biosynthesis proteins 0.0000696
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000028081
Domain Number - Region: 60-82
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.00216
Family MoCo biosynthesis proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028081   Gene: ENSMMUG00000021315   Transcript: ENSMMUT00000030004
Sequence length 633
Comment pep:known_by_projection chromosome:MMUL_1:4:39740820:39763098:-1 gene:ENSMMUG00000021315 transcript:ENSMMUT00000030004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSWKLRTDVRIREGAGGSPCASPQPGSKGPCFLPALSLQELSRRRQFLREHAAPFSAFLT
DSFGRQHSYLRISLTEKCNLRCESPSWAPSGLIGVKAELYDCRSFLILSFLFKLGLVNIA
SPKTSKQSDPFLAVLIAQLQRLEGLRTIGVTTNGINLTRLLPQLQKAGLSAINISLDTLV
PAKFEFIVRRKGFHKVMEGIHKAIELGYNPVKVNCVVMRGLNEDELLDFAALTEGLPLDV
RFIEYMPFDGNKWNFKKMVSYKEMLDTIRQQWPELEKLPEEESSTAKAFKIPGFQGQISF
ITSMSEHFCGTCNRLRITADGNLKVCLFGNSEVSLRDHLRAGASEQELLRIIGAAVGRKK
RQHAGMFSISQMKNRPMILIELFLMFHDSPPANPSISSWDPLHVQGLRPRMSFSSQMVTL
WKGCRVPQALLLAQQRLGSGCFQRHYTSRADSDANSKCLSPGSWAPAAPSGPQLTSEQLT
HVDSEGRAAMVDVGRKPDTERAAVASAVVLLGPVAFKLVQRNQLKKGDALVVAQLAGIQA
AKVTSQLIPLCHHVALSHVQVQLELDSTRHAVRIQASCRARGPTGVEMEALTSAAVAALS
LYDMCKAVSRDIVLEEIKLISKTGGQRGDFHRA
Download sequence
Identical sequences ENSMMUP00000028081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]