SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028111 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028111
Domain Number 1 Region: 31-289
Classification Level Classification E-value
Superfamily Carbonic anhydrase 4.71e-92
Family Carbonic anhydrase 0.000000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028111   Gene: ENSMMUG00000021338   Transcript: ENSMMUT00000030038
Sequence length 354
Comment pep:known chromosome:MMUL_1:7:41695465:41753923:-1 gene:ENSMMUG00000021338 transcript:ENSMMUT00000030038 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSSLHAAAVLLLVILKEQPSSPAPANGSKWTYLGPDGENSWSKKYPSCGGLLQSPIDL
HSDILQYDASLMPLEFQGYNLSANEQFLLTNNGHSVKLNLPSDMHIQGLQSRYSATQLHL
HWGNPNDPHGSEHTVSGQHFAAELHIVHYNSDLYPDASTASNKSEGLAVLAVLIEMGPFN
PSYDKIFSHLQHVKYKGQEAFIPGFNIEELLPERTAEYYRYRGSLTTPPCNPTVLWTVFR
NPVQISQEQLLALETALYCTHMDDPSPREMINNFRQVQKFDERLVYTSFSQVQAYTAAGL
SLGIILSLALAGVLGICIVMAVSIWLFRRKSIKKGDNKGVIYKPAIKEETEAHA
Download sequence
Identical sequences A0A2K5TSC4 F7DLJ4
XP_005559798.1.63531 XP_014997838.1.72884 9544.ENSMMUP00000028111 ENSMMUP00000028111 ENSMMUP00000028111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]